PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016461851.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 233aa    MW: 26201.6 Da    PI: 9.4705
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016461851.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-135397347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E+ l++++ + +G+g W++I++ +   Rt+ q+ s+ qky
   XP_016461851.1 53 AWTEDEQRLFLKGLEIHGKGKWAKISKDLLPSRTPTQIASHAQKY 97
                     6***************************999*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.17446102IPR017930Myb domain
SuperFamilySSF466899.72E-1548102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-124998IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-1349100IPR006447Myb domain, plants
SMARTSM007171.9E-1150100IPR001005SANT/Myb domain
PfamPF002497.4E-125397IPR001005SANT/Myb domain
CDDcd001671.13E-115398No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGRKCTLCGR NGHNYRTCSE KSKTIKLFGV KISTSSSAIC KKDNGRKIKK GIAWTEDEQR  60
LFLKGLEIHG KGKWAKISKD LLPSRTPTQI ASHAQKYFMR LEYASNDRKS RKKPSVFDVH  120
LQKTQESMNL EEISEETIVS EHDIKIVPLE NQDQETANSQ VVTPIATSQS IPNYYNVLPI  180
TWVHHMYDYP AFYASGIDSV ASTSASGTMD QRLSGVSSHW SQSSKDNLDL TLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766348.11e-176PREDICTED: transcription factor MYB1R1-like
RefseqXP_016461851.11e-176PREDICTED: transcription factor MYB1R1-like
TrEMBLM1D8F11e-60M1D8F1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000849453e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.16e-31MYB_related family protein